Gefunden 27 Produkte für "

coffee bag packing machine

"
  • Qualität Vorgefertigte Taschenverpackungsmaschine mit Tropffilter 3,7 kW Vorgefertigte Taschenverpackungsmaschine Fabrik

    Ansicht mehr

    Vorgefertigte Taschenverpackungsmaschine mit Tropffilter 3,7 kW Vorgefertigte Taschenverpackungsmaschine

    Hot Selling QNPP-K22 Pre-made Drip Filter Bag Inner And Outer Packing Machine High Speed Long Serving Life The QNPP-K22 Drip Filter Bag Packing Machine is a high-performance automatic packaging equipment specifically designed for ground coffee and various small particulate materials. It integrates a full set of automatic functions to meet the efficient, standardized and high-quality packaging needs of food processing, beverage and other related industries. With its fashionabl

  • Qualität Innere Außen Teebeutel Verpackungsmaschine Automatische Teestoffverpackungsmaschine 3,7kw Fabrik

    Ansicht mehr

    Innere Außen Teebeutel Verpackungsmaschine Automatische Teestoffverpackungsmaschine 3,7kw

    Top Quality Hot Selling Fully Automatic Inner and Outer Tea Bag Packing Machine | Custom Tag & String Tea Dust Packaging Machine Our fully automatic custom tag and string tea bag packing machine is a professional upgraded packaging solution tailored for tea dust, tea fragments, fine tea powder and coffee powder packaging. Integrating inner and outer bag forming, string and tag attaching, precise metering, sealing and coding in one automated workflow, this three-side and back

  • Qualität Vertikale automatische Flüssigkeitsverpackungsmaschine Runde Ecke Taschenfüllmaschine 1,5 kW Fabrik

    Ansicht mehr

    Vertikale automatische Flüssigkeitsverpackungsmaschine Runde Ecke Taschenfüllmaschine 1,5 kW

    Vertical Liquid Packaging Machine | Fully Automatic Round Corner Sachet Filling Machine for Sea Buckthorn Berry Puree Coffee Liquid & Cat Strips Elevate your liquid product packaging efficiency with our QNPP-H100S fully automatic vertical liquid filling and packaging machine, a multi-functional packaging solution designed for diverse liquid and semi-liquid products. Ideal for sea buckthorn puree, goji berry puree, concentrated coffee liquid, pet nutrition cat strips and other

  • Qualität Anpassungsfähige Mehrspur-Verpackungsmaschine Pulver-Stick-Verpackungsmaschine 380V Fabrik

    Ansicht mehr

    Anpassungsfähige Mehrspur-Verpackungsmaschine Pulver-Stick-Verpackungsmaschine 380V

    Hot Selling Full Automatic Multi-Lane Powder Packaging Machine | Customizable High-Speed Powder Filling Machine for Coffee, Protein & Milk Powder Our full-automatic multi-row powder packaging machine QNMP-ZB320 is a high-efficiency, low-energy industrial packaging solution tailored for large-scale powder production lines. Specially designed for strip-shaped solid beverages, coffee powder, protein powder, milk powder, flour, salt, pepper and various fine powder materials, this

  • Qualität Multi-Fluid-Füllmaschine für die Industrie Großvolumenaseptische Beutelfüllmaschine 1,5 kW Fabrik

    Ansicht mehr

    Multi-Fluid-Füllmaschine für die Industrie Großvolumenaseptische Beutelfüllmaschine 1,5 kW

    QNAP-AF1 Industrial Aseptic Bag Filling Machine | Multi-Fluid Large Volume Filling Equipment The QNAP-AF1 industrial aseptic bag filling machine is a high-performance, large-volume filling solution designed for modern food and beverage manufacturing. Integrating professional aseptic technology, flexible volume adjustment and fully automated operation, this single-head large-bag filling equipment supports industrial-grade sterile packaging for a wide range of fluid materials,

  • Qualität Hochgeschwindigkeits-Mehrschienenpackmaschine Pulverbeutelfüllmaschine 11 kW Fabrik

    Ansicht mehr

    Hochgeschwindigkeits-Mehrschienenpackmaschine Pulverbeutelfüllmaschine 11 kW

    Top Seller Factory Price High-End Multi-Lane Powder Packing Machine for Probiotic, Coffee & Nutrition Powder High Quality Low Investment Upgrade your large-scale powder packaging production with our premium fully automatic multi-lane powder packing machine, professionally engineered for probiotic powder, coffee solid beverage, and nutritional powder packaging. Designed for modern factory mass production, this upgraded intelligent packaging production line delivers top-tier

  • Qualität 1.8kw Teepakemaschine Hochgeschwindigkeit Hochpräzision Teebeutel Verpackungsmaschine Fabrik

    Ansicht mehr

    1.8kw Teepakemaschine Hochgeschwindigkeit Hochpräzision Teebeutel Verpackungsmaschine

    Top Seller High Speed High Precision QNTP-11 Inner Tea Bag Packaging Machine with String and Tag In the fast-growing tea and health product packaging industry, finding a cost-effective and high-quality automatic packaging solution is the key to enhancing competitiveness for small and medium-sized enterprises. Our QNTP-11 Inner Tea Bag Packaging Machine with String and Tag stands out from similar products with its reliable quality, affordable price, and all-in-one automatic

  • Qualität Hängende automatische Kaffee-Verpackungsmaschine der Ohr-Kaffee-Verpackungsmaschine-3.7kw 220V/380V Fabrik

    Ansicht mehr

    Hängende automatische Kaffee-Verpackungsmaschine der Ohr-Kaffee-Verpackungsmaschine-3.7kw 220V/380V

    Hot Selling Factory Price Fully Automatic Hanging Ear Coffee Packaging Machine | Ultrasonic Non-woven Inner & Outer Bag Filling & Sealing Machine Upgrade your coffee packaging production with our high-efficiency fully automatic hanging ear coffee packaging machine, model QNCP-JT181. Designed for precision and stability, this all-in-one equipment integrates automatic measuring, cutting, bag making, filling and sealing processes, realizing one-stop packaging for hanging ear

  • Qualität 220V-Teeverpackungsmaschine 1.6kw Kaffeepod-Verpackungsmaschine mit CE-Zertifizierung Fabrik

    Ansicht mehr

    220V-Teeverpackungsmaschine 1.6kw Kaffeepod-Verpackungsmaschine mit CE-Zertifizierung

    Hot Selling Low Investment QNTP-66 Tea & Coffee Round Pod Packaging Machine: High Quality with CE Certification For businesses engaged in tea, coffee, food, medicine and chemical industries, a high-quality, certified and efficient packaging machine is essential to enhance product competitiveness and expand market reach. The QNTP-66 Tea & Coffee Round Cake Packaging Machine is professionally designed for granular materials, featuring excellent quality, CE certification and

  • Qualität Hochgeschwindigkeitskaffeeverpackungsmaschine 50Hz 1,4kw Teeverpackungsmaschine Fabrik

    Ansicht mehr

    Hochgeschwindigkeitskaffeeverpackungsmaschine 50Hz 1,4kw Teeverpackungsmaschine

    High-Speed, Reliable & Affordable Back Seal Coffee Tea Granule Packaging Machine – Model QNCP-61BK Struggling with slow production lines or inconsistent packaging quality? Upgrade your packaging process with the QNCP-61BK Back Seal Granule Packaging Machine, a solution engineered for businesses that demand speed, precision, and value. Designed to meet the rigorous standards of the food, chemical, and cosmetic industries, this machine transforms your workflow from manual labor

  • Qualität Drei-Seiten-Kaffeepakemaschine vollautomatische Pulverfüllmaschine 1,8kw Fabrik

    Ansicht mehr

    Drei-Seiten-Kaffeepakemaschine vollautomatische Pulverfüllmaschine 1,8kw

    Hot Selling Fully Automatic Three-side Seal Powder Packaging Machine | Coffee & Solid Drink Filling Packing Equipment Upgrade your powder packaging production line with our QNPP-F100 fully automatic three-side seal powder filling machine, specially engineered for coffee powder, solid beverage powder and various loose powder packaging needs. Designed for commercial production efficiency and stable packaging quality, this all-in-one packaging equipment integrates intelligent

  • Qualität Verpackungsmaschine mit Doppelkolonne Flüssig-Stick-Verpackung Maschine mit automatischer Pulver-Stick-Verpackung 9 kW Fabrik

    Ansicht mehr

    Verpackungsmaschine mit Doppelkolonne Flüssig-Stick-Verpackung Maschine mit automatischer Pulver-Stick-Verpackung 9 kW

    New Generation Multi-Column Liquid Packaging Machine | Automatic Coffee & Lemon Stock Solution Filling Machine Our new generation fully automatic multi-column liquid strip packaging machine is a high-efficiency, food-grade quantitative filling and packaging solution, specially designed for liquid materials such as coffee stock solution, lemon concentrate, and various liquid food ingredients. Integrating metering, bag forming, automatic filling, color code tracking, fixed